POP4 antibody (70R-1342)

Rabbit polyclonal POP4 antibody

Synonyms Polyclonal POP4 antibody, Anti-POP4 antibody, POP4, Processing Of Precursor 4 Ribonuclease P/Mrp Subunit antibody, POP 4 antibody, POP-4, POP 4, POP-4 antibody
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen POP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL
Assay Information POP4 Blocking Peptide, catalog no. 33R-2327, is also available for use as a blocking control in assays to test for specificity of this POP4 antibody


Immunohistochemical staining using POP4 antibody (70R-1342)

POP4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of POP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using POP4 antibody (70R-1342) | POP4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using POP4 antibody (70R-1342) | POP4 antibody (70R-1342) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors