POPDC3 antibody (70R-6374)

Rabbit polyclonal POPDC3 antibody raised against the C terminal of POPDC3

Synonyms Polyclonal POPDC3 antibody, Anti-POPDC3 antibody, Popeye Domain Containing 3 antibody, POPDC3, POP3 antibody, POPDC-3 antibody, POPDC 3, bA355M14.1 antibody, MGC22671 antibody, POPDC-3, POPDC 3 antibody
Specificity POPDC3 antibody was raised against the C terminal of POPDC3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen POPDC3 antibody was raised using the C terminal of POPDC3 corresponding to a region with amino acids YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ
Assay Information POPDC3 Blocking Peptide, catalog no. 33R-10174, is also available for use as a blocking control in assays to test for specificity of this POPDC3 antibody

Images

Western Blot analysis using POPDC3 antibody (70R-6374)

POPDC3 antibody (70R-6374) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POPDC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POPDC3 is a member of the POP family of proteins containing three putative transmembrane domains. The protein is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POPDC3 antibody (70R-6374) | POPDC3 antibody (70R-6374) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors