PORCN antibody (70R-6584)

Rabbit polyclonal PORCN antibody

Synonyms Polyclonal PORCN antibody, Anti-PORCN antibody, DHOF antibody, MG61 antibody, por antibody, Porcupine Homolog antibody, MGC29687 antibody, PORC antibody, PPN antibody, FODH antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PORCN antibody was raised using a synthetic peptide corresponding to a region with amino acids ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF
Assay Information PORCN Blocking Peptide, catalog no. 33R-1079, is also available for use as a blocking control in assays to test for specificity of this PORCN antibody

Images

Western Blot analysis using PORCN antibody (70R-6584)

PORCN antibody (70R-6584) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PORCN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PORCN belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PORCN antibody (70R-6584) | PORCN antibody (70R-6584) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors