POSTN antibody (70R-6066)

Rabbit polyclonal POSTN antibody raised against the N terminal of POSTN

Synonyms Polyclonal POSTN antibody, Anti-POSTN antibody, MGC119510 antibody, OSF-2 antibody, periostin antibody, PN antibody, PDLPOSTN antibody, MGC119511 antibody, RP11-412K4.1 antibody, Periostin Osteoblast Specific Factor antibody
Specificity POSTN antibody was raised against the N terminal of POSTN
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen POSTN antibody was raised using the N terminal of POSTN corresponding to a region with amino acids RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL
Assay Information POSTN Blocking Peptide, catalog no. 33R-7797, is also available for use as a blocking control in assays to test for specificity of this POSTN antibody

Images

Immunohistochemical staining using POSTN antibody (70R-6066)

POSTN antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POSTN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POSTN binds to heparin. Induces cell attachment and spreading and plays a role in cell adhesion. POSTN may play a role in extracellular matrix mineralization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using POSTN antibody (70R-6066) | POSTN antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using POSTN antibody (70R-6066) | POSTN antibody (70R-6066) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using POSTN antibody (70R-6066) | POSTN antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors