Pou4f3 Blocking Peptide (33R-10379)

A synthetic peptide for use as a blocking control in assays to test for specificity of Pou4f3 antibody, catalog no. 70R-7967

Synonyms Pou4f3 control peptide, Pou4f3 antibody Blocking Peptide, Anti-Pou4f3 Blocking Peptide, POU domain, class 4, transcription factor 3 Blocking Peptide, Brn3.1 Blocking Peptide, Brn3c Blocking Peptide, ddl Blocking Peptide, dreidel Blocking Peptide, Pou4f3, Pouf3-4, Pouf3 4, Pouf3-4 Blocking Peptide, Pouf3 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH
Molecular Weight 37 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Pou4f3 may play a role in determining or maintaining the identities of a small subset of visual system neurons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors