PP2447 antibody (70R-1269)

Rabbit polyclonal PP2447 antibody raised against the N terminal Of Pp2447

Synonyms Polyclonal PP2447 antibody, Anti-PP2447 antibody, PP-2447, RP3-402G11.12 antibody, LP6054 antibody, PP-2447 antibody, PP2447 antibody, PP 2447 antibody, PP 2447, PP2447, MGC110928 antibody
Specificity PP2447 antibody was raised against the N terminal Of Pp2447
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen PP2447 antibody was raised using the N terminal Of Pp2447 corresponding to a region with amino acids MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK
Assay Information PP2447 Blocking Peptide, catalog no. 33R-5833, is also available for use as a blocking control in assays to test for specificity of this PP2447 antibody


Western Blot analysis using PP2447 antibody (70R-1269)

PP2447 antibody (70R-1269) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PP2447 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PP2447 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PP2447 antibody (70R-1269) | PP2447 antibody (70R-1269) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors