PPAPDC2 antibody (70R-6945)

Rabbit polyclonal PPAPDC2 antibody raised against the N terminal of PPAPDC2

Synonyms Polyclonal PPAPDC2 antibody, Anti-PPAPDC2 antibody, PPAPDC 2, FLJ90191 antibody, FLJ46512 antibody, Phosphatidic Acid Phosphatase Type 2 Domain Containing 2 antibody, PPAPDC 2 antibody, bA6J24.6 antibody, MGC15483 antibody, PPAPDC2, PSDP antibody, PPAPDC-2, PPAPDC-2 antibody
Specificity PPAPDC2 antibody was raised against the N terminal of PPAPDC2
Cross Reactivity Human
Applications WB
Immunogen PPAPDC2 antibody was raised using the N terminal of PPAPDC2 corresponding to a region with amino acids FPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVC
Assay Information PPAPDC2 Blocking Peptide, catalog no. 33R-3021, is also available for use as a blocking control in assays to test for specificity of this PPAPDC2 antibody

Images

Western Blot analysis using PPAPDC2 antibody (70R-6945)

PPAPDC2 antibody (70R-6945) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPAPDC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPAPDC2 is the phosphatase that dephosphorylates presqualene diphosphate (PSDP) into presqualene monophosphate (PSMP), suggesting that it may be indirectly involved in innate immunity. PSDP is a bioactive lipid that rapidly remodels to presqualene monophosphate PSMP upon cell activation. PPAPDC2 displays diphosphate phosphatase activity with a substrate preference for PSDP > FDP > phosphatidic acid.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPAPDC2 antibody (70R-6945) | PPAPDC2 antibody (70R-6945) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors