PPIB antibody (70R-7220)

Rabbit polyclonal PPIB antibody

Synonyms Polyclonal PPIB antibody, Anti-PPIB antibody, SCYLP antibody, Peptidylprolyl Isomerase B antibody, Cyclophilin B antibody, CYPB antibody, MGC14109 antibody, MGC2224 antibody, CYP-S1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids KKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKG
Assay Information PPIB Blocking Peptide, catalog no. 33R-4476, is also available for use as a blocking control in assays to test for specificity of this PPIB antibody

Images

Western Blot analysis using PPIB antibody (70R-7220)

PPIB antibody (70R-7220) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPIB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPIB antibody (70R-7220) | PPIB antibody (70R-7220) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors