PPID antibody (70R-4331)

Rabbit polyclonal PPID antibody

Synonyms Polyclonal PPID antibody, Anti-PPID antibody, Peptidylprolyl Isomerase D antibody, MGC33096 antibody, CYP-40 antibody, Cyclophilin D antibody, CYPD antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen PPID antibody was raised using a synthetic peptide corresponding to a region with amino acids CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
Assay Information PPID Blocking Peptide, catalog no. 33R-1762, is also available for use as a blocking control in assays to test for specificity of this PPID antibody

Images

Western blot analysis using PPID antibody (70R-4331)

Recommended PPID Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPID antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPID is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using PPID antibody (70R-4331) | Recommended PPID Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors