PPIF antibody (70R-1119)

Rabbit polyclonal PPIF antibody

Synonyms Polyclonal PPIF antibody, Anti-PPIF antibody, CYP3 antibody, Cyp-D antibody, Peptidylprolyl Isomerase F antibody, FLJ90798 antibody, MGC117207 antibody, Cyclophilin F antibody
Cross Reactivity Human,Rat,Dog
Applications WB
Immunogen PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS
Assay Information PPIF Blocking Peptide, catalog no. 33R-3589, is also available for use as a blocking control in assays to test for specificity of this PPIF antibody


Western Blot analysis using PPIF antibody (70R-1119)

PPIF antibody (70R-1119) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPIF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPIF is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPIF antibody (70R-1119) | PPIF antibody (70R-1119) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors