PPM1A antibody (70R-5788)

Rabbit polyclonal PPM1A antibody

Synonyms Polyclonal PPM1A antibody, Anti-PPM1A antibody, Protein Phosphatase 1A antibody, PPM1, PP2C-ALPHA antibody, MGC9201 antibody, PPM-1, PP2CA antibody, PPM-1 antibody, PPM 1, PPM 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPM1A antibody was raised using a synthetic peptide corresponding to a region with amino acids EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK
Assay Information PPM1A Blocking Peptide, catalog no. 33R-2464, is also available for use as a blocking control in assays to test for specificity of this PPM1A antibody

Images

Western Blot analysis using PPM1A antibody (70R-5788)

PPM1A antibody (70R-5788) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPM1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPM1A antibody (70R-5788) | PPM1A antibody (70R-5788) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors