PPM1K antibody (70R-2456)

Rabbit polyclonal PPM1K antibody

Synonyms Polyclonal PPM1K antibody, Anti-PPM1K antibody, Pp2C Domain Containing antibody, PPM1, Protein Phosphatase 1K antibody, PTMP antibody, DKFZp761G058 antibody, PPM 1, UG0882E07 antibody, PPM 1 antibody, DKFZp667B084 antibody, PPM-1 antibody, PPM-1, PP2Cm antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPM1K antibody was raised using a synthetic peptide corresponding to a region with amino acids AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA
Assay Information PPM1K Blocking Peptide, catalog no. 33R-1241, is also available for use as a blocking control in assays to test for specificity of this PPM1K antibody

Images

Western Blot analysis using PPM1K antibody (70R-2456)

PPM1K antibody (70R-2456) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPM1K antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPM1K regulates the mitochondrial permeability transition pore and is essential for cellular survival and development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPM1K antibody (70R-2456) | PPM1K antibody (70R-2456) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors