PPM1M antibody (70R-3588)

Rabbit polyclonal PPM1M antibody raised against the middle region of PPM1M

Synonyms Polyclonal PPM1M antibody, Anti-PPM1M antibody, PPM1, FLJ32332 antibody, PPM 1 antibody, PPM-1 antibody, PPM-1, PP2Ceta antibody, PPM 1, PP2C-eta antibody, PP2CE antibody, Protein Phosphatase Mg2+/Mn2+ Dependent 1M antibody
Specificity PPM1M antibody was raised against the middle region of PPM1M
Cross Reactivity Human
Applications WB
Immunogen PPM1M antibody was raised using the middle region of PPM1M corresponding to a region with amino acids VYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKY
Assay Information PPM1M Blocking Peptide, catalog no. 33R-9923, is also available for use as a blocking control in assays to test for specificity of this PPM1M antibody

Images

Western Blot analysis using PPM1M antibody (70R-3588)

PPM1M antibody (70R-3588) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPM1M antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPM1M belongs to the PP2C family. It contains 1 PP2C-like domain. The exact function of PPM1M is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPM1M antibody (70R-3588) | PPM1M antibody (70R-3588) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors