PPM1M antibody (70R-3594)

Rabbit polyclonal PPM1M antibody

Synonyms Polyclonal PPM1M antibody, Anti-PPM1M antibody, PPM-1 antibody, PPM 1, Pp2C Domain Containing antibody, PP2Ceta antibody, PPM 1 antibody, FLJ32332 antibody, Protein Phosphatase 1M antibody, PP2CE antibody, PP2C-eta antibody, PPM1, PPM-1
Cross Reactivity Human,Mouse
Applications WB
Immunogen PPM1M antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL
Assay Information PPM1M Blocking Peptide, catalog no. 33R-8149, is also available for use as a blocking control in assays to test for specificity of this PPM1M antibody


Western Blot analysis using PPM1M antibody (70R-3594)

PPM1M antibody (70R-3594) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPM1M antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPM1M belongs to the PP2C family. It contains 1 PP2C-like domain. The exact function of PPM1M is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPM1M antibody (70R-3594) | PPM1M antibody (70R-3594) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors