PPME1 antibody (70R-3708)

Rabbit polyclonal PPME1 antibody raised against the N terminal of PPME1

Synonyms Polyclonal PPME1 antibody, Anti-PPME1 antibody, PME-1 antibody, PPME-1, PPME 1 antibody, PPME-1 antibody, FLJ22226 antibody, Protein Phosphatase Methylesterase 1 antibody, PPME1, PPME 1
Specificity PPME1 antibody was raised against the N terminal of PPME1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen PPME1 antibody was raised using the N terminal of PPME1 corresponding to a region with amino acids MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYF
Assay Information PPME1 Blocking Peptide, catalog no. 33R-6394, is also available for use as a blocking control in assays to test for specificity of this PPME1 antibody


Western Blot analysis using PPME1 antibody (70R-3708)

PPME1 antibody (70R-3708) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPME1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPME1 antibody (70R-3708) | PPME1 antibody (70R-3708) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors