PPP1R11 antibody (70R-3745)

Rabbit polyclonal PPP1R11 antibody

Synonyms Polyclonal PPP1R11 antibody, Anti-PPP1R11 antibody, PPPR-1 antibody, PPP1R11, PPPR-1, HCG-V antibody, PPPR 1 antibody, PPPR 1, TCTE5 antibody, TCTEX5 antibody, MGC125743 antibody, MGC125741 antibody, MGC125742 antibody, HCGV antibody, Protein Phosphatase 1 Regulatory Inhibitor Subunit 11 antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen PPP1R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN
Assay Information PPP1R11 Blocking Peptide, catalog no. 33R-5629, is also available for use as a blocking control in assays to test for specificity of this PPP1R11 antibody

Images

Western Blot analysis using PPP1R11 antibody (70R-3745)

PPP1R11 antibody (70R-3745) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP1R11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPP1R11 antibody (70R-3745) | PPP1R11 antibody (70R-3745) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors