PPP1R13B antibody (70R-6023)

Rabbit polyclonal PPP1R13B antibody

Synonyms Polyclonal PPP1R13B antibody, Anti-PPP1R13B antibody, PPPR3B 1, PPP1R13B, PPPR3B-1, p85 antibody, ASPP1 antibody, PPPR3B-1 antibody, PPPR3B 1 antibody, p53BP2-like antibody, Protein Phosphatase 1 Regulatory Inhibitor Subunit 13B antibody, KIAA0771 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPP1R13B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA
Assay Information PPP1R13B Blocking Peptide, catalog no. 33R-2400, is also available for use as a blocking control in assays to test for specificity of this PPP1R13B antibody

Images

Western Blot analysis using PPP1R13B antibody (70R-6023)

PPP1R13B antibody (70R-6023) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 119 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP1R13B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPP1R13B is a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPP1R13B antibody (70R-6023) | PPP1R13B antibody (70R-6023) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors