PPP1R3A antibody (70R-6844)

Rabbit polyclonal PPP1R3A antibody

Synonyms Polyclonal PPP1R3A antibody, Anti-PPP1R3A antibody, Protein Phosphatase 1 Regulatory Inhibitor Subunit 3A antibody, PPPR3A 1, PPPR3A-1, PPP1R3A, PPP1R3 antibody, PP1G antibody, PPPR3A 1 antibody, PPPR3A-1 antibody
Cross Reactivity Human
Applications WB
Immunogen PPP1R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE
Assay Information PPP1R3A Blocking Peptide, catalog no. 33R-5946, is also available for use as a blocking control in assays to test for specificity of this PPP1R3A antibody

Images

Western Blot analysis using PPP1R3A antibody (70R-6844)

PPP1R3A antibody (70R-6844) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 126 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP1R3A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The glycogen-associated form of protein phosphatase-1 (PP1) derived from skeletal muscle is a heterodimer composed of a 37 kDa catalytic subunit and a 124 kDa targeting and regulatory subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPP1R3A antibody (70R-6844) | PPP1R3A antibody (70R-6844) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors