PPP1R8 antibody (70R-1468)
Rabbit polyclonal PPP1R8 antibody
Overview
Overview
Synonyms | Polyclonal PPP1R8 antibody, Anti-PPP1R8 antibody, PPPR8 1, PPPR8-1, PPP1R8, PPPR8 1 antibody, Protein Phosphatase 1 Regulatory Inhibitor Subunit 8 antibody, PPPR8-1 antibody |
---|---|
Cross Reactivity | Human,Mouse,Rat,Dog |
Applications | WB |
Immunogen | PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD |
Assay Information | PPP1R8 Blocking Peptide, catalog no. 33R-9105, is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody |
Images
Western Blot analysis using PPP1R8 antibody (70R-1468)
PPP1R8 antibody (70R-1468) used at 1.25 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Total IgG Protein A purified |
Molecular Weight | 39 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPP1R8 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1.25 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product