PPP2R1A antibody (70R-6079)

Rabbit polyclonal PPP2R1A antibody

Synonyms Polyclonal PPP2R1A antibody, Anti-PPP2R1A antibody, PPPR-2 antibody, PR65A antibody, PPP2R, MGC786 antibody, PPPR 2 antibody, Protein Phosphatase 2 regulatory subunit A alpha isoform antibody, PPPR 2, PPPR-2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPP2R1A antibody was raised using a synthetic peptide corresponding to a region with amino acids KAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYP
Assay Information PPP2R1A Blocking Peptide, catalog no. 33R-4262, is also available for use as a blocking control in assays to test for specificity of this PPP2R1A antibody


Western blot analysis using PPP2R1A antibody (70R-6079)

Recommended PPP2R1A Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP2R1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. PPP2R1A is an alpha isoform of the constant regulatory subunit A.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using PPP2R1A antibody (70R-6079) | Recommended PPP2R1A Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors