PPP2R3B antibody (70R-5584)

Rabbit polyclonal PPP2R3B antibody

Synonyms Polyclonal PPP2R3B antibody, Anti-PPP2R3B antibody, NY-REN-8 antibody, PPPR-2, PPP2R3L antibody, PPP2R3LY antibody, Protein Phosphatase 2 regulatory subunit B beta isoform antibody, PR48 antibody, PPPR 2, PPP2R, PPPR 2 antibody, PPPR-2 antibody
Cross Reactivity Human
Applications WB
Immunogen PPP2R3B antibody was raised using a synthetic peptide corresponding to a region with amino acids TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETA
Assay Information PPP2R3B Blocking Peptide, catalog no. 33R-9062, is also available for use as a blocking control in assays to test for specificity of this PPP2R3B antibody


Western Blot analysis using PPP2R3B antibody (70R-5584)

PPP2R3B antibody (70R-5584) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP2R3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPP2R3B antibody (70R-5584) | PPP2R3B antibody (70R-5584) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors