PPP2R5D antibody (70R-4534)

Rabbit polyclonal PPP2R5D antibody raised against the middle region of PPP2R5D

Synonyms Polyclonal PPP2R5D antibody, Anti-PPP2R5D antibody, B56D antibody, PPPR-2, MGC8949 antibody, MGC2134 antibody, PPPR 2 antibody, PPP2R, PPPR 2, Protein Phosphatase 2 Regulatory Subunit B Delta Isoform antibody, PPPR-2 antibody
Specificity PPP2R5D antibody was raised against the middle region of PPP2R5D
Cross Reactivity Human
Applications WB
Immunogen PPP2R5D antibody was raised using the middle region of PPP2R5D corresponding to a region with amino acids ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA
Assay Information PPP2R5D Blocking Peptide, catalog no. 33R-2756, is also available for use as a blocking control in assays to test for specificity of this PPP2R5D antibody

Images

Western Blot analysis using PPP2R5D antibody (70R-4534)

PPP2R5D antibody (70R-4534) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP2R5D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPP2R5D antibody (70R-4534) | PPP2R5D antibody (70R-4534) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors