PPP3R1 antibody (70R-4295)

Rabbit polyclonal PPP3R1 antibody

Synonyms Polyclonal PPP3R1 antibody, Anti-PPP3R1 antibody, PPP 3 antibody, PPP-3, PPP-3 antibody, CALNB1 antibody, CNB1 antibody, Protein Phosphatase 3 regulatory B subunit alpha isoform antibody, CNB antibody, PPP3, PPP 3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPP3R1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ
Assay Information PPP3R1 Blocking Peptide, catalog no. 33R-6049, is also available for use as a blocking control in assays to test for specificity of this PPP3R1 antibody

Images

Western Blot analysis using PPP3R1 antibody (70R-4295)

PPP3R1 antibody (70R-4295) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP3R1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPP3R1 is the regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. PPP3R1 confers calcium sensitivity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPP3R1 antibody (70R-4295) | PPP3R1 antibody (70R-4295) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors