PPP4R2 antibody (70R-3940)

Rabbit polyclonal PPP4R2 antibody raised against the C terminal of PPP4R2

Synonyms Polyclonal PPP4R2 antibody, Anti-PPP4R2 antibody, Protein Phosphatase 4 Regulatory Subunit 2 antibody, PPP-4 antibody, PPP 4, PPP-4, MGC131930 antibody, PPP4, PPP 4 antibody
Specificity PPP4R2 antibody was raised against the C terminal of PPP4R2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPP4R2 antibody was raised using the C terminal of PPP4R2 corresponding to a region with amino acids DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE
Assay Information PPP4R2 Blocking Peptide, catalog no. 33R-2177, is also available for use as a blocking control in assays to test for specificity of this PPP4R2 antibody


Western Blot analysis using PPP4R2 antibody (70R-3940)

PPP4R2 antibody (70R-3940) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP4R2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPP4R2 is the regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). It may regulate the activity of PPP4C at centrosomal microtubule organizing centers. Its interaction with the SMN complex leads to enhance the temporal localization of snRNPs, suggesting a role of PPP4C in maturation of spliceosomal snRNPs. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPP4R2 antibody (70R-3940) | PPP4R2 antibody (70R-3940) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors