PPP5C antibody (70R-5672)

Rabbit polyclonal PPP5C antibody raised against the N terminal of PPP5C

Synonyms Polyclonal PPP5C antibody, Anti-PPP5C antibody, PPP 5 antibody, PPP5, PPP5 antibody, PPP 5, PPP-5, Protein Phosphatase 5 Catalytic Subunit antibody, PPP-5 antibody, PP5 antibody, FLJ36922 antibody
Specificity PPP5C antibody was raised against the N terminal of PPP5C
Cross Reactivity Human, Mouse
Applications WB
Immunogen PPP5C antibody was raised using the N terminal of PPP5C corresponding to a region with amino acids MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF
Assay Information PPP5C Blocking Peptide, catalog no. 33R-5701, is also available for use as a blocking control in assays to test for specificity of this PPP5C antibody

Images

Western Blot analysis using PPP5C antibody (70R-5672)

PPP5C antibody (70R-5672) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP5C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPP5C antibody (70R-5672) | PPP5C antibody (70R-5672) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors