PPWD1 antibody (70R-4237)

Rabbit polyclonal PPWD1 antibody raised against the middle region of PPWD1

Synonyms Polyclonal PPWD1 antibody, Anti-PPWD1 antibody, PPWD1, KIAA0073 antibody, PPWD-1, PPWD 1 antibody, Peptidylprolyl Isomerase Domain And Wd Repeat Containing 1 antibody, PPWD 1, PPWD-1 antibody
Specificity PPWD1 antibody was raised against the middle region of PPWD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPWD1 antibody was raised using the middle region of PPWD1 corresponding to a region with amino acids FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG
Assay Information PPWD1 Blocking Peptide, catalog no. 33R-2998, is also available for use as a blocking control in assays to test for specificity of this PPWD1 antibody

Images

Western Blot analysis using PPWD1 antibody (70R-4237)

PPWD1 antibody (70R-4237) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPWD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPWD1 antibody (70R-4237) | PPWD1 antibody (70R-4237) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors