PQLC1 antibody (70R-7332)

Rabbit polyclonal PQLC1 antibody raised against the middle region of PQLC1

Synonyms Polyclonal PQLC1 antibody, Anti-PQLC1 antibody, PQLC-1, PQLC 1 antibody, PQLC 1, PQLC1, PQLC-1 antibody, FLJ22378 antibody, Pq Loop Repeat Containing 1 antibody
Specificity PQLC1 antibody was raised against the middle region of PQLC1
Cross Reactivity Human
Applications WB
Immunogen PQLC1 antibody was raised using the middle region of PQLC1 corresponding to a region with amino acids TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW
Assay Information PQLC1 Blocking Peptide, catalog no. 33R-9395, is also available for use as a blocking control in assays to test for specificity of this PQLC1 antibody

Images

Western Blot analysis using PQLC1 antibody (70R-7332)

PQLC1 antibody (70R-7332) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PQLC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PQLC1 is a multi-pass membrane protein. It contains 2 PQ-loop domains. The exact function of PQLC1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PQLC1 antibody (70R-7332) | PQLC1 antibody (70R-7332) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors