PRDX5 antibody (70R-5755)

Rabbit polyclonal PRDX5 antibody raised against the middle region of PRDX5

Synonyms Polyclonal PRDX5 antibody, Anti-PRDX5 antibody, PMP20 antibody, B166 antibody, ACR1 antibody, MGC117264 antibody, PRDX-5, PLP antibody, PRXV antibody, MGC142285 antibody, PRDX-5 antibody, PRDX5, PRDX6 antibody, PRDX 5, SBBI10 antibody, MGC142283 antibody, AOEB166 antibody, PRDX 5 antibody, Peroxiredoxin 5 antibody
Specificity PRDX5 antibody was raised against the middle region of PRDX5
Cross Reactivity Human
Applications WB
Immunogen PRDX5 antibody was raised using the middle region of PRDX5 corresponding to a region with amino acids TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI
Assay Information PRDX5 Blocking Peptide, catalog no. 33R-9012, is also available for use as a blocking control in assays to test for specificity of this PRDX5 antibody

Images

Western Blot analysis using PRDX5 antibody (70R-5755)

PRDX5 antibody (70R-5755) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRDX5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRDX5 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRDX5 antibody (70R-5755) | PRDX5 antibody (70R-5755) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors