PRELID2 antibody (70R-4202)

Rabbit polyclonal PRELID2 antibody raised against the C terminal of PRELID2

Synonyms Polyclonal PRELID2 antibody, Anti-PRELID2 antibody, Preli Domain Containing 2 antibody, FLJ38376 antibody, MGC21644 antibody, PRELID2, PRELID 2, PRELID-2, PRELID-2 antibody, PRELID 2 antibody
Specificity PRELID2 antibody was raised against the C terminal of PRELID2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRELID2 antibody was raised using the C terminal of PRELID2 corresponding to a region with amino acids GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE
Assay Information PRELID2 Blocking Peptide, catalog no. 33R-3533, is also available for use as a blocking control in assays to test for specificity of this PRELID2 antibody

Images

Western Blot analysis using PRELID2 antibody (70R-4202)

PRELID2 antibody (70R-4202) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRELID2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRELID2 contains 1 PRELI/MSF1 domain. The exact function of PRELID2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRELID2 antibody (70R-4202) | PRELID2 antibody (70R-4202) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors