PRELP antibody (70R-5343)

Rabbit polyclonal PRELP antibody raised against the middle region of PRELP

Synonyms Polyclonal PRELP antibody, Anti-PRELP antibody, MST161 antibody, SLRR2A antibody, MSTP161 antibody, MGC45323 antibody, Proline/Arginine-Rich End Leucine-Rich Repeat Protein antibody
Specificity PRELP antibody was raised against the middle region of PRELP
Cross Reactivity Human
Applications WB
Immunogen PRELP antibody was raised using the middle region of PRELP corresponding to a region with amino acids SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH
Assay Information PRELP Blocking Peptide, catalog no. 33R-8653, is also available for use as a blocking control in assays to test for specificity of this PRELP antibody


Western Blot analysis using PRELP antibody (70R-5343)

PRELP antibody (70R-5343) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRELP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRELP is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRELP antibody (70R-5343) | PRELP antibody (70R-5343) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors