PREP antibody (70R-4323)

Rabbit polyclonal PREP antibody raised against the N terminal of PREP

Synonyms Polyclonal PREP antibody, Anti-PREP antibody, Prolyl Endopeptidase antibody, PEP antibody, PE antibody, MGC16060 antibody
Specificity PREP antibody was raised against the N terminal of PREP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PREP antibody was raised using the N terminal of PREP corresponding to a region with amino acids THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF
Assay Information PREP Blocking Peptide, catalog no. 33R-9102, is also available for use as a blocking control in assays to test for specificity of this PREP antibody

Images

Western Blot analysis using PREP antibody (70R-4323)

PREP antibody (70R-4323) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PREP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PREP antibody (70R-4323) | PREP antibody (70R-4323) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors