PREP antibody (70R-4324)

Rabbit polyclonal PREP antibody raised against the middle region of PREP

Synonyms Polyclonal PREP antibody, Anti-PREP antibody, MGC16060 antibody, Prolyl Endopeptidase antibody, PEP antibody, PE antibody
Specificity PREP antibody was raised against the middle region of PREP
Cross Reactivity Human,Mouse
Applications WB
Immunogen PREP antibody was raised using the middle region of PREP corresponding to a region with amino acids LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM
Assay Information PREP Blocking Peptide, catalog no. 33R-5028, is also available for use as a blocking control in assays to test for specificity of this PREP antibody

Images

Western Blot analysis using PREP antibody (70R-4324)

PREP antibody (70R-4324) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PREP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PREP antibody (70R-4324) | PREP antibody (70R-4324) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors