Presenilin 1 antibody (70R-6264)

Rabbit polyclonal Presenilin 1 antibody raised against the N terminal of PSEN1

Synonyms Polyclonal Presenilin 1 antibody, Anti-Presenilin 1 antibody, PS1 antibody, AD3 antibody, FAD antibody, S182 antibody, PSEN1 antibody
Specificity Presenilin 1 antibody was raised against the N terminal of PSEN1
Cross Reactivity Human
Applications WB
Immunogen Presenilin 1 antibody was raised using the N terminal of PSEN1 corresponding to a region with amino acids TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY
Assay Information Presenilin 1 Blocking Peptide, catalog no. 33R-9260, is also available for use as a blocking control in assays to test for specificity of this Presenilin 1 antibody

Images

Western Blot analysis using Presenilin 1 antibody (70R-6264)

Presenilin 1 antibody (70R-6264) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSEN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1; PSEN2) or in the amyloid precursor protein (APP).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Presenilin 1 antibody (70R-6264) | Presenilin 1 antibody (70R-6264) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors