PRIM1 antibody (70R-1617)

Rabbit polyclonal PRIM1 antibody raised against the N terminal of PRIM1

Synonyms Polyclonal PRIM1 antibody, Anti-PRIM1 antibody, PRIM1, PRIM-1 antibody, PRIM 1, p49 antibody, PRIM-1, Primase Polypeptide 1 49Kda antibody, MGC12308 antibody, PRIM 1 antibody
Specificity PRIM1 antibody was raised against the N terminal of PRIM1
Cross Reactivity Human, Mouse
Applications WB
Immunogen PRIM1 antibody was raised using the N terminal of PRIM1 corresponding to a region with amino acids SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM
Assay Information PRIM1 Blocking Peptide, catalog no. 33R-8737, is also available for use as a blocking control in assays to test for specificity of this PRIM1 antibody

Images

Western Blot analysis using PRIM1 antibody (70R-1617)

PRIM1 antibody (70R-1617) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRIM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. PRIM1 is the small, 49 kDa primase subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRIM1 antibody (70R-1617) | PRIM1 antibody (70R-1617) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors