PRKAA1 antibody (70R-5929)

Rabbit polyclonal PRKAA1 antibody raised against the N terminal of PRKAA1

Synonyms Polyclonal PRKAA1 antibody, Anti-PRKAA1 antibody, AMPK antibody, MGC33776 antibody, Protein Kinase Amp-Activated Alpha 1 Catalytic Subunit antibody, AMPKa1 antibody, MGC57364 antibody
Specificity PRKAA1 antibody was raised against the N terminal of PRKAA1
Cross Reactivity Human
Applications WB
Immunogen PRKAA1 antibody was raised using the N terminal of PRKAA1 corresponding to a region with amino acids GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH
Assay Information PRKAA1 Blocking Peptide, catalog no. 33R-3235, is also available for use as a blocking control in assays to test for specificity of this PRKAA1 antibody

Images

Western Blot analysis using PRKAA1 antibody (70R-5929)

PRKAA1 antibody (70R-5929) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKAA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRKAA1 antibody (70R-5929) | PRKAA1 antibody (70R-5929) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors