PRKAA1 antibody (70R-5932)

Rabbit polyclonal PRKAA1 antibody raised against the middle region of PRKAA1

Synonyms Polyclonal PRKAA1 antibody, Anti-PRKAA1 antibody, MGC57364 antibody, MGC33776 antibody, AMPK antibody, Protein Kinase Amp-Activated Alpha 1 Catalytic Subunit antibody, AMPKa1 antibody
Specificity PRKAA1 antibody was raised against the middle region of PRKAA1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRKAA1 antibody was raised using the middle region of PRKAA1 corresponding to a region with amino acids SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
Assay Information PRKAA1 Blocking Peptide, catalog no. 33R-8915, is also available for use as a blocking control in assays to test for specificity of this PRKAA1 antibody

Images

Western Blot analysis using PRKAA1 antibody (70R-5932)

PRKAA1 antibody (70R-5932) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKAA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRKAA1 antibody (70R-5932) | PRKAA1 antibody (70R-5932) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors