PRKAA2 antibody (70R-3231)

Rabbit polyclonal PRKAA2 antibody raised against the middle region of PRKAA2

Synonyms Polyclonal PRKAA2 antibody, Anti-PRKAA2 antibody, PRKAA antibody, AMPK antibody, Protein Kinase Amp-Activated Alpha 2 Catalytic Subunit antibody, AMPK2 antibody
Specificity PRKAA2 antibody was raised against the middle region of PRKAA2
Cross Reactivity Human, Mouse
Applications WB
Immunogen PRKAA2 antibody was raised using the middle region of PRKAA2 corresponding to a region with amino acids AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP
Assay Information PRKAA2 Blocking Peptide, catalog no. 33R-1630, is also available for use as a blocking control in assays to test for specificity of this PRKAA2 antibody

Images

Western Blot analysis using PRKAA2 antibody (70R-3231)

PRKAA2 antibody (70R-3231) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKAA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRKAA2 antibody (70R-3231) | PRKAA2 antibody (70R-3231) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors