PRKRA antibody (70R-5896)

Rabbit polyclonal PRKRA antibody raised against the middle region of PRKRA

Synonyms Polyclonal PRKRA antibody, Anti-PRKRA antibody, Protein Kinase Interferon-Inducible Double Stranded Rna Dependent Activator antibody
Specificity PRKRA antibody was raised against the middle region of PRKRA
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen PRKRA antibody was raised using the middle region of PRKRA corresponding to a region with amino acids RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA
Assay Information PRKRA Blocking Peptide, catalog no. 33R-8043, is also available for use as a blocking control in assays to test for specificity of this PRKRA antibody

Images

Immunohistochemical staining using PRKRA antibody (70R-5896)

PRKRA antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKRA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PRKRA antibody (70R-5896) | PRKRA antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X
  • Western Blot analysis using PRKRA antibody (70R-5896) | PRKRA antibody (70R-5896) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors