PRKRA antibody (70R-5897)

Rabbit polyclonal PRKRA antibody raised against the N terminal of PRKRA

Synonyms Polyclonal PRKRA antibody, Anti-PRKRA antibody, PACT antibody, RAX antibody, HSD14 antibody, Protein Kinase Interferon-Inducible Double Stranded Rna Dependent Activator antibody
Specificity PRKRA antibody was raised against the N terminal of PRKRA
Cross Reactivity Human
Applications WB
Immunogen PRKRA antibody was raised using the N terminal of PRKRA corresponding to a region with amino acids MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP
Assay Information PRKRA Blocking Peptide, catalog no. 33R-6483, is also available for use as a blocking control in assays to test for specificity of this PRKRA antibody

Images

Western blot analysis using PRKRA antibody (70R-5897)

Recommended PRKRA Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKRA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using PRKRA antibody (70R-5897) | Recommended PRKRA Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors