PRKY antibody (70R-3691)

Rabbit polyclonal PRKY antibody raised against the N terminal of PRKY

Synonyms Polyclonal PRKY antibody, Anti-PRKY antibody, Protein Kinase Y-Linked antibody
Specificity PRKY antibody was raised against the N terminal of PRKY
Cross Reactivity Human
Applications WB
Immunogen PRKY antibody was raised using the N terminal of PRKY corresponding to a region with amino acids MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD
Assay Information PRKY Blocking Peptide, catalog no. 33R-5895, is also available for use as a blocking control in assays to test for specificity of this PRKY antibody

Images

Western Blot analysis using PRKY antibody (70R-3691)

PRKY antibody (70R-3691) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKY antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromsoome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRKY antibody (70R-3691) | PRKY antibody (70R-3691) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors