PRMT2 antibody (70R-2116)

Rabbit polyclonal PRMT2 antibody raised against the middle region of PRMT2

Synonyms Polyclonal PRMT2 antibody, Anti-PRMT2 antibody, PRMT 2 antibody, PRMT-2 antibody, HRMT1L1 antibody, Protein Arginine Methyltransferase 2 antibody, PRMT 2, MGC111373 antibody, PRMT-2, PRMT2
Specificity PRMT2 antibody was raised against the middle region of PRMT2
Cross Reactivity Human
Applications WB
Immunogen PRMT2 antibody was raised using the middle region of PRMT2 corresponding to a region with amino acids VHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIW
Assay Information PRMT2 Blocking Peptide, catalog no. 33R-9584, is also available for use as a blocking control in assays to test for specificity of this PRMT2 antibody

Images

Western Blot analysis using PRMT2 antibody (70R-2116)

PRMT2 antibody (70R-2116) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRMT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRMT2 antibody (70R-2116) | PRMT2 antibody (70R-2116) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors