PRMT3 antibody (70R-3706)

Rabbit polyclonal PRMT3 antibody raised against the middle region of PRMT3

Synonyms Polyclonal PRMT3 antibody, Anti-PRMT3 antibody, HRMT1L3 antibody, PRMT-3 antibody, PRMT-3, Protein Arginine Methyltransferase 3 antibody, PRMT 3 antibody, PRMT3, PRMT 3
Specificity PRMT3 antibody was raised against the middle region of PRMT3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRMT3 antibody was raised using the middle region of PRMT3 corresponding to a region with amino acids LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK
Assay Information PRMT3 Blocking Peptide, catalog no. 33R-4896, is also available for use as a blocking control in assays to test for specificity of this PRMT3 antibody

Images

Western Blot analysis using PRMT3 antibody (70R-3706)

PRMT3 antibody (70R-3706) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRMT3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRMT3 antibody (70R-3706) | PRMT3 antibody (70R-3706) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors