PRMT5 antibody (70R-1032)

Rabbit polyclonal PRMT5 antibody raised against the N terminal of PRMT5

Synonyms Polyclonal PRMT5 antibody, Anti-PRMT5 antibody, Protein Arginine Methyltransferase 5 antibody, PRMT 5 antibody, PRMT-5, PRMT 5, PRMT5, PRMT-5 antibody
Specificity PRMT5 antibody was raised against the N terminal of PRMT5
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen PRMT5 antibody was raised using the N terminal of PRMT5 corresponding to a region with amino acids FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS
Assay Information PRMT5 Blocking Peptide, catalog no. 33R-2864, is also available for use as a blocking control in assays to test for specificity of this PRMT5 antibody


Immunohistochemical staining using PRMT5 antibody (70R-1032)

PRMT5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRMT5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRMT5 methylates specific arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3 to monomethylarginine and to symmetrical dimethylarginines (sDMAs). It methylates SUPT5H. PRMT5 plays a role in the assembly of snRNP core particles and may play a role in cytokine-activated transduction pathways. It negatively regulates cyclin E1 promoter activity and cellular proliferation and May regulate the SUPT5H transcriptional elongation properties. It may be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. PRMT5 methylates histone H2A/H4 'Arg-3' during germ cell development and methylates histone H3 'Arg-8', which may repress transcription.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PRMT5 antibody (70R-1032) | PRMT5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.
  • Western Blot analysis using PRMT5 antibody (70R-1032) | PRMT5 antibody (70R-1032) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using PRMT5 antibody (70R-1032) | PRMT5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar ceils (arrows) in Human Lung. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors