PRMT7 antibody (70R-3564)

Rabbit polyclonal PRMT7 antibody raised against the N terminal of PRMT7

Synonyms Polyclonal PRMT7 antibody, Anti-PRMT7 antibody, PRMT 7, PRMT 7 antibody, PRMT-7, PRMT7, Protein Arginine Methyltransferase 7 antibody, KIAA1933 antibody, PRMT-7 antibody, FLJ10640 antibody
Specificity PRMT7 antibody was raised against the N terminal of PRMT7
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen PRMT7 antibody was raised using the N terminal of PRMT7 corresponding to a region with amino acids MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQ
Assay Information PRMT7 Blocking Peptide, catalog no. 33R-6141, is also available for use as a blocking control in assays to test for specificity of this PRMT7 antibody


Western Blot analysis using PRMT7 antibody (70R-3564)

PRMT7 antibody (70R-3564) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRMT7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Arginine methylation is an apparently irreversible protein modification catalyzed by arginine methyltransferases, such as PMT7, using S-adenosylmethionine (AdoMet) as the methyl donor. Arginine methylation is implicated in signal transduction, RNA transport, and RNA splicing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRMT7 antibody (70R-3564) | PRMT7 antibody (70R-3564) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors