PRMT8 antibody (70R-1263)

Rabbit polyclonal PRMT8 antibody raised against the C terminal of PRMT8

Synonyms Polyclonal PRMT8 antibody, Anti-PRMT8 antibody, PRMT 8, PRMT-8, Protein Arginine Methyltransferase 8 antibody, PRMT-8 antibody, HRMT1L3 antibody, PRMT8, PRMT 8 antibody
Specificity PRMT8 antibody was raised against the C terminal of PRMT8
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PRMT8 antibody was raised using the C terminal of PRMT8 corresponding to a region with amino acids YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND
Assay Information PRMT8 Blocking Peptide, catalog no. 33R-10164, is also available for use as a blocking control in assays to test for specificity of this PRMT8 antibody

Images

Western Blot analysis using PRMT8 antibody (70R-1263)

PRMT8 antibody (70R-1263) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRMT8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRMT8 probably methylates the guanidino nitrogens of arginyl residues in some proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRMT8 antibody (70R-1263) | PRMT8 antibody (70R-1263) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors