Prodynorphin antibody (70R-4021)

Rabbit polyclonal Prodynorphin antibody raised against the middle region of PDYN

Synonyms Polyclonal Prodynorphin antibody, Anti-Prodynorphin antibody, PDYN antibody, MGC26418 antibody, PENKB antibody
Specificity Prodynorphin antibody was raised against the middle region of PDYN
Cross Reactivity Human
Applications WB
Immunogen Prodynorphin antibody was raised using the middle region of PDYN corresponding to a region with amino acids SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE
Assay Information Prodynorphin Blocking Peptide, catalog no. 33R-8391, is also available for use as a blocking control in assays to test for specificity of this Prodynorphin antibody


Western Blot analysis using Prodynorphin antibody (70R-4021)

Prodynorphin antibody (70R-4021) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDYN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Prodynorphin antibody (70R-4021) | Prodynorphin antibody (70R-4021) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors