Protein C antibody (70R-5495)

Rabbit polyclonal Protein C antibody

Synonyms Polyclonal Protein C antibody, Anti-Protein C antibody, PROC1 antibody, Inactivator Of Coagulation Factors Va And Viiia antibody, PROC antibody
Cross Reactivity Human
Applications WB
Immunogen Protein C antibody was raised using a synthetic peptide corresponding to a region with amino acids PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD
Assay Information Protein C Blocking Peptide, catalog no. 33R-6997, is also available for use as a blocking control in assays to test for specificity of this Protein C antibody


Western Blot analysis using Protein C antibody (70R-5495)

Protein C antibody (70R-5495) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PROC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Protein C antibody (70R-5495) | Protein C antibody (70R-5495) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors