Protor 2 antibody (70R-3938)

Rabbit polyclonal Protor 2 antibody raised against the middle region of FLJ14213

Synonyms Polyclonal Protor 2 antibody, Anti-Protor 2 antibody, FLJ14213 antibody, Protor-2 antibody, Protor -2, Protor -2 antibody, Protor 2 antibody, MGC16218 antibody, Protor 2, Protor 2
Specificity Protor 2 antibody was raised against the middle region of FLJ14213
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Protor 2 antibody was raised using the middle region of FLJ14213 corresponding to a region with amino acids LNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQ
Assay Information Protor 2 Blocking Peptide, catalog no. 33R-5255, is also available for use as a blocking control in assays to test for specificity of this Protor 2 antibody


Western Blot analysis using Protor 2 antibody (70R-3938)

Protor 2 antibody (70R-3938) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FLJ14213 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Protor 2 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Protor 2 antibody (70R-3938) | Protor 2 antibody (70R-3938) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors