PRPF4 antibody (70R-4650)

Rabbit polyclonal PRPF4 antibody

Synonyms Polyclonal PRPF4 antibody, Anti-PRPF4 antibody, Prp4p antibody, Prp4 Pre-mRNA Processing Factor 4 Homolog antibody, PRPF 4 antibody, PRPF-4 antibody, PRPF4, PRPF-4, PRP4 antibody, PRPF 4, HPRP4P antibody, HPRP4 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRPF4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT
Assay Information PRPF4 Blocking Peptide, catalog no. 33R-2784, is also available for use as a blocking control in assays to test for specificity of this PRPF4 antibody


Western Blot analysis using PRPF4 antibody (70R-4650)

PRPF4 antibody (70R-4650) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRPF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRPF4 antibody (70R-4650) | PRPF4 antibody (70R-4650) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors