PRPF8 antibody (70R-4944)

Rabbit polyclonal PRPF8 antibody

Synonyms Polyclonal PRPF8 antibody, Anti-PRPF8 antibody, PRPF 8, HPRP8 antibody, PRPF-8, RP13 antibody, PRPF-8 antibody, PRPF8, Prp8 Pre-mRNA Processing Factor 8 Homolog antibody, PRP8 antibody, PRPF 8 antibody, PRPC8 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRPF8 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPR
Assay Information PRPF8 Blocking Peptide, catalog no. 33R-8515, is also available for use as a blocking control in assays to test for specificity of this PRPF8 antibody

Images

Western Blot analysis using PRPF8 antibody (70R-4944)

PRPF8 antibody (70R-4944) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 273 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRPF8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Pre-mRNA splicing occurs in 2 sequential transesterification steps. PRPF8 is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. The gene encoding PRPF8 is a candidate gene for autosomal dominant retinitis pigmentosa.Pre-mRNA splicing occurs in 2 sequential transesterification steps.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRPF8 antibody (70R-4944) | PRPF8 antibody (70R-4944) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors